SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000000083 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000000083
Domain Number 1 Region: 596-611,647-789
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.9e-26
Family Laminin G-like module 0.0053
Further Details:      
 
Domain Number 2 Region: 127-218
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.45e-16
Family Laminin G-like module 0.0092
Further Details:      
 
Domain Number 3 Region: 316-423
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.38e-16
Family Laminin G-like module 0.011
Further Details:      
 
Domain Number 4 Region: 2-49
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000000142
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.011
Further Details:      
 
Domain Number 5 Region: 850-943
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000133
Family Laminin G-like module 0.029
Further Details:      
 
Domain Number 6 Region: 421-457
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000156
Family EGF-type module 0.018
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000000083
Domain Number - Region: 449-497
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000663
Family Fibrinogen C-terminal domain-like 0.011
Further Details:      
 
Domain Number - Region: 988-1046
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0613
Family Laminin G-like module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000000083   Gene: ENSEEUG00000000093   Transcript: ENSEEUT00000000093
Sequence length 1177
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_5465:2483:258497:1 gene:ENSEEUG00000000093 transcript:ENSEEUT00000000093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KFAGNMNADSVMHHKLLHSVRARFIRFVPLEWNPSGKIGMRIEAYGCSYXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDS
KPRFSSSLPSATLGSLLDDQHWHSVLIERVGKQVNFTVDKYTQHFRTKGETDALDIDYEL
SFGGIPVPGKPGTFLKKNFHGCIENLYYNGVNIIDLAKRRKHQIYTXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXSSLNDGLWHSVSINARRNRITLTLDNDAASPTQDTTRVQIFSGNR
YYFGGCPDNFNDSQCFNPINAFQGCMRLIFIDNQPKDLISVQQGSLGNFSDLHIDLCSIK
DRCLPNYCEHGGSCSQSWTTFYCNCNDTGYMGVTCHNSLYEQSCEVYRHQGNAAGFFYID
SDGSGPRAPLQVYCNITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXGTPFTWWIGRSNERHPYWGGAPPGVQQCECGLDES
CLDIRHFCNCDADKDEWTNDTGFLSFKDHLPVTQIVITDTNRSNSEAAWRIGPLRCYGDR
HFWNAASFYTEASYLHFPTLHAEFSADISFFFKTTALSGVFLENLGIKDFIRLEISSPSE
ITFAIDVGNGPIELIVQSPSPLNDNQWHYIWAERNLKETTLQVDSLPKMTRETSEEGHFR
LQLNSQLFIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXYFCDCTNSAYEGPFFKEVSAVFEIGTSVTYMFQEPYPVTKDISLSSSA
IYIDTAPSKENIAFSFVTSKAPSLLLYINSSQDFLAVLLCRNGXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXMDQRPELTYTFSPEVEFRAARSLTLGKITETPGL
DSEVAKANVQGFIGCLSSVQYNHIAPLKAALRHTTSAPVTIQGTLRESTCGSVMDSDVSA
VTTVHSSSDPFGKTDEREPLTNAVRSDSAVIGGVIAVVIFIIFSIIGIMTRFLYQHKQSL
RTNQMKEKEYPENLDSSFRNDIDLQNTVSECKREYFI
Download sequence
Identical sequences ENSEEUP00000000083 ENSEEUP00000000083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]