SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000000199 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000000199
Domain Number 1 Region: 64-209
Classification Level Classification E-value
Superfamily EF-hand 1.21e-37
Family Calmodulin-like 0.000000255
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000000199   Gene: ENSEEUG00000000230   Transcript: ENSEEUT00000000229
Sequence length 211
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_8280:2271:25741:1 gene:ENSEEUG00000000230 transcript:ENSEEUT00000000229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPKKDVPVKKPAPAGLSISKTAVKPAAGAPPVKTKAEAMPAGLRASEKPHEPPIDLSKV
VIEFNKDQLEEFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPRNDEL
KSRRVDFETFLPMLQTVAKNRDQGTYEDYLEGLRVFDKEGNGKVMGAELRHVLTTLGEKM
TEEEVESVLAGHEDSNGCINYEAFLKHILSV
Download sequence
Identical sequences A0A1S3ADT0
ENSEEUP00000000199 XP_007533405.1.11023 ENSEEUP00000000199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]