SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000000203 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000000203
Domain Number 1 Region: 15-120
Classification Level Classification E-value
Superfamily EF-hand 1.41e-23
Family Calmodulin-like 0.00000628
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000000203   Gene: ENSEEUG00000000233   Transcript: ENSEEUT00000000233
Sequence length 121
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_8280:26617:27992:1 gene:ENSEEUG00000000233 transcript:ENSEEUT00000000233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CDFTEDQTADLTPSARFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNP
KSDEMNVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVQ
L
Download sequence
Identical sequences ENSEEUP00000000203 ENSEEUP00000000203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]