SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000000292 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000000292
Domain Number 1 Region: 104-153
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000712
Family Pleckstrin-homology domain (PH domain) 0.00011
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000000292
Domain Number - Region: 2-39
Classification Level Classification E-value
Superfamily SH2 domain 0.000362
Family SH2 domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000000292   Gene: ENSEEUG00000000329   Transcript: ENSEEUT00000000329
Sequence length 153
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_663:1412:4459:1 gene:ENSEEUG00000000329 transcript:ENSEEUT00000000329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AKDSVKHFHVEHTGHSFKFGFNEFTSLRDFVTHFANEPLIGSETXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTWKTRWFTLHRNELKY
FKDQMSPEPIRILDLTECSAVQFDYSQERVNCF
Download sequence
Identical sequences ENSEEUP00000000292 ENSEEUP00000000292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]