SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000000335 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000000335
Domain Number 1 Region: 644-767
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.97e-36
Family Protein kinases, catalytic subunit 0.00053
Further Details:      
 
Domain Number 2 Region: 379-497
Classification Level Classification E-value
Superfamily PH domain-like 5.19e-32
Family Pleckstrin-homology domain (PH domain) 0.0000145
Further Details:      
 
Domain Number 3 Region: 82-154
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.27e-20
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00071
Further Details:      
 
Domain Number 4 Region: 220-278
Classification Level Classification E-value
Superfamily Cysteine-rich domain 3.14e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000000335   Gene: ENSEEUG00000000381   Transcript: ENSEEUT00000000383
Sequence length 868
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_7852:87103:293631:-1 gene:ENSEEUG00000000381 transcript:ENSEEUT00000000383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APVGGISSHLQIGLSREPVLLLQDSSGDYSLAHVREMACSIVDQKFPECGFYGMYDKILL
FRHDPTSENILRLVRAASDIQEGDLIEVVLSASATFEDFQIRPHALFVHSYRAPAFCDHC
GEMLWGLVRQGLKCEGCGLNYHKRCAFKIPNNCSGVRRRRLSNVSLTGLSTIRTASAELS
SSGPDEPLLQKSPSESFIGREKRSNSQSYIGRPIQLDKILMSKVKVPHTFVIHSYTRPTV
CQYCKKLLKGLFRQGLQCKDCRFNCHKRCAPKVPNNCLGEVTIMSNLLSPGAESDVVMEE
GSDDNDSERNSALMDDMEEAMVQDAEMVMAECHDGGEMQDPDPDQEDSNRTISPSTSNNI
PLMRVVQSVKHTKRKSSTVMKEGWMVHYTSKDTLRKRHYWRLDSKCITLFQNDTGSRYYK
EIPLSEILSLEPAKPSVSVPNGANPHCFEITTANVVYYVGEHVVTPSSPPPSGSVLTSGI
GADVARMWEMAIQHALMPVNPKGSANSGTSSHRDISVSISVSNSQIQENVDISTVYQIFP
DEVLGSGQFGIVYGGEPRETGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXILVALRHLHFKNIVHC
DLKPENVLLASADPFPQAXVKLCDFGFAIIGEKSFRRSVVGTPAYLAPEVLRNKGYNRSL
DMWSVGVIIYVSLSGTFPFNEDEDIHDQIQNAAFMYPPNPWKEISHEXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXDYQTWLDLRELECKIGERYITHESDDLRWEQYAGEQGMQYPAHL
IDPSASHSDSPETEETEMKALSERVSIL
Download sequence
Identical sequences ENSEEUP00000000335 ENSEEUP00000000335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]