SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000000350 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000000350
Domain Number 1 Region: 3-154
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.35e-49
Family IMD domain 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000000350
Domain Number - Region: 207-248
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0272
Family IMD domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000000350   Gene: ENSEEUG00000000398   Transcript: ENSEEUT00000000398
Sequence length 755
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_4984:16635:189219:-1 gene:ENSEEUG00000000398 transcript:ENSEEUT00000000398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAVIEKECSALGGLFQTIISDMKGSYPVWEDFINKAGKLQSQLRTTVVAAAAFLDAFQK
VADMATSTRGGTREIGSALTRMCMRHRSIEAKLRQFSSALIDCLINPLQEQMEEWKKVAN
QLDKDHAKEYKKARQEIKKKSSDTLKLQKKAKKXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXEEEISMLGEITHLQTISEDLKSLTMDPHKLPSSS
EQVILDLKGSDYSWXXXXXXXXXXXXXXXXXXXXXSLNSVNSSDSRSSGSHSHSPSSHYR
YRSSNLAQQAPVRLSSVSSHDSGFISQDAFQSKSPSPMPPEAPNQLSNGFSHSSLSSESH
VGLMGTNLFPHCLPASRLLPRVTSVHLPDYAHYYTIGPGMFPSSQIPSWKXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPGEEMEACEELA
LALSRGLQLDTQRSSRDSLQCSSGYSTQTTTPCCSEDTIPSQVSDYDYFSVSGDQEADQQ
EFDKSSTIPRNSDIGQSYRRMFQAKRPASTAGLPTTLGPAMVTPGVATIRRTPSTKPSVR
RGTIGAGPIPIKTPVIPVKTPTVPDLPMRLPAPPDGPEERGEHSPESPSVGEGLQGVISM
PSSLWSGQAAINPPLPGLKSSIPEEHRQVIPESEAEDQERDPSNATASPGQIPESDPADL
SPRDAPQGEDMLNAIRRGVKLKKTTTNDRSAPRFS
Download sequence
Identical sequences ENSEEUP00000000350 ENSEEUP00000000350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]