SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000000437 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSEEUP00000000437
Domain Number - Region: 505-572
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000314
Family BAR domain 0.035
Further Details:      
 
Domain Number - Region: 37-69
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.0196
Family MgtE N-terminal domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000000437   Gene: ENSEEUG00000000491   Transcript: ENSEEUT00000000492
Sequence length 614
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_3058:3707:59717:1 gene:ENSEEUG00000000491 transcript:ENSEEUT00000000492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDQIKFIVDNLNKEPFRKNYNLITFDSLEPMQLLQVLNDVLAEIDPKQVADVREEMPEQ
TAKRMLSLLGILKYKPPGNATDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXYEELMEAFKTLHKECEQLKTSGFSTAEIRRDISAMEE
EKDQLIKRVERLKKRVEPVQNHQQMLKIARQLRVEKEREEFLIQQKQEQKNQXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXLLKRLEEEIKFNSYMVTEKFPKELENKKKXXXXXXXXXX
XXXXXXXXXXXXXXXINEIGTEINQLIEKKMMRNEPFEGKLSLYRQQASIISRKKEAKAE
ELQEAKEKLARLEKELSMKTNQTRESGGTEVLKADEFKRFVNKLRGKSTVFKKNHQLIAG
LKAEFGVLQRTEELLKQRHEHIQHQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXVKKLNSLVSEKKSALAPILKELRELRQKCQELTQEYDEKKSQYDSCAAGLE
SNRSKLEQEVRRLREECNQEESKYHYTNCMIKNLEIQLCRATDMKAYVSSDQQEKRKXXX
XYTKNIAEQENLGK
Download sequence
Identical sequences ENSEEUP00000000437 ENSEEUP00000000437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]