SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000000450 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000000450
Domain Number 1 Region: 538-693
Classification Level Classification E-value
Superfamily Sec7 domain 2.49e-49
Family Sec7 domain 0.0000775
Further Details:      
 
Domain Number 2 Region: 746-867
Classification Level Classification E-value
Superfamily PH domain-like 2.33e-25
Family Pleckstrin-homology domain (PH domain) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000000450   Gene: ENSEEUG00000000506   Transcript: ENSEEUT00000000506
Sequence length 944
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_488:3610:15446:-1 gene:ENSEEUG00000000506 transcript:ENSEEUT00000000506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKDAMPCCSKGDRSLCPPKRRTCWLLCAVPRVHSASSAGAASVLRMSFRTQRGRPVIPP
CGPSPGCLSLKFAPSPWGPSSPTGQPPPGAQSSVVIFRFVEKASVRPLNGLPAPGGLSRS
WDLGGVSSPRATPALGPGSSRKLRLEASTSDPLPAGRRSALPGRQGLLHGPPAQPQVGAD
GLYSSLPNGLGAPSEHLATATLFRGSAEIGLLNQEDIWSSPREVSSHAQRIARAKWEFFY
GSLDPPSSGAKPPEQAPPSSHGVGSGQGSGVAVGRAAKYSETDLDTVPLRCYRETDIDEV
LAEREEADSAIESQPSSEGPPGTARPHAPRPSPCLDPRPSLSSGDEDEAGGEEDVDDEVF
EASEGPRPGTWMPHSGPLKSPGPFLPGTSPSADGPDSFSCLFEAILESHRAKGTSYTSLT
SLEALASPGPTQSPFFTFELPPQPPAPRPDPPAPAPLAPFELDSGTSSAADGPWTRRGEE
EEAKAGAKKAPEREPPSPCHSEDSFGLGASPLGSEPPLSQLVSDSDSELDSTERLALGST
DTLSNGQKADLEAAQRLAKRLYRLDGFRKADVARHLGKNNDFSKLVAGEYLKFFVFTGMT
LDQALRVFLKELALMGETQERERVLAHFSQRYFQCNPGALSSEDGAHTLTCALMLLNTDL
HGHNIGKRMTCGDFIGNLEGLNEGCDFPRELLKXXXXXXXXXXXXXXXDEEELRRSLSTW
PDPNPKVIIRVSGGSGSSTSPFLDLTPEPGAAVYKHGALVRKVHADPDCRKTPRGKRGWK
SFHGILKGMILYLQKEEYQPGKALCEAELKNAISIHHALATRANDYSKRPHVFYLRTADW
RVFLFQASSLEQMQSWITRINVVAAMFSAPPFPAAVSSQKKFSRPLLPSAATRLSQEEQV
QTHEAKLKAMASELREHRASQLSKKAPGREAEEQRQKEAYLEFE
Download sequence
Identical sequences ENSEEUP00000000450 ENSEEUP00000000450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]