SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000000466 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000000466
Domain Number 1 Region: 1120-1189
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000236
Family SAM (sterile alpha motif) domain 0.012
Further Details:      
 
Domain Number 2 Region: 593-663
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000275
Family SAM (sterile alpha motif) domain 0.0012
Further Details:      
 
Domain Number 3 Region: 543-613
Classification Level Classification E-value
Superfamily SH3-domain 0.000000186
Family SH3-domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000000466   Gene: ENSEEUG00000000524   Transcript: ENSEEUT00000000527
Sequence length 1198
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_2272:61918:184902:1 gene:ENSEEUG00000000524 transcript:ENSEEUT00000000527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GMSEAFSRLWTDVMGILXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
EKPDASPSLQLQSQTEXXXXXXXXXXXXXXXXXNPLHKSNSEDGSVGKGDWKKKNKYFWQ
NFRKNQKGIMRQTSKGEDVGYVASEITMSDEERIQLMMMVKEKMITIEEALARXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXSREQSDDDTEESVKFKRLHKLVNSTRRVRKKLI
RVEDMKKPSTEGGEEHVFESPPVLDERSALYSGVHKKPFSFDGSPEKPPEESPDSLTTSP
SSSSLDTWGAGRKLFKTFSKGESRGLIKPPMKMGTFFSYPEEEKAQKVSRSLTEGEMKKG
LGSLSHGRTCSFGGFDLTNRSLHIGSSNVDPMXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXKGDIIDIISKPPMGTWMGLLNNKVGTFKFIYVDVLNEEEEKPKRPTRRRRKGRPPQPK
SVEDLLDRINLKXXXPTFLFNGYAYLDTFKLLEEEDLDELNIKDPEHRAVLLTAVELLQE
YDSNSDQSGSQEKLLVENQGLKGCSPRDSGCYESSENLENXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXKQQGEEDRLGALAPALPADQPGTSGLSQNRHSLPVSVC
RSCEILEGPVPVEAWPRSHSLNDLHGEPGQATAPLPPLLPEVPQKTTPSATPKAKPQDSA
VDNAWLLTQSKRLLGPQKGALKKVEGFLAATAGGPSSPTCLPKNHDAQIPGAKSTVPRTS
LEGHHKGLEFEGVCHPQGTKEGVDAEPRGPEVRTQTKHPSQPPPVPTKKSRERLANGLPP
VPMAPGEPSPNAPSLPVKRGSSSDYHPVQVPRSPTGQEPDSPSSPKPPPWLSELPGSTSL
QEHGVKLGPPVTRKVSCVRGINLETLTENKLQTEGIDLTEEPYSDKHGRCGIPEALVQRY
AEDLERPERDIAANMDQIRVKLLRKQHRMAIPSGGLTEICRKPLSPGCISSMSDWLTSIG
LPMYTSTLAEAGFGSLGQVPSLSHSCLEEAGITEERHRSKLVSAARLFKLPPPGPEAM
Download sequence
Identical sequences ENSEEUP00000000466 ENSEEUP00000000466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]