SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000000471 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000000471
Domain Number 1 Region: 32-246
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.15e-66
Family SPRY domain 0.0000000121
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000000471
Domain Number - Region: 235-272
Classification Level Classification E-value
Superfamily SOCS box-like 0.000238
Family SOCS box-like 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000000471   Gene: ENSEEUG00000000534   Transcript: ENSEEUT00000000533
Sequence length 273
Comment pep:known_by_projection scaffold:HEDGEHOG:scaffold_342119:58073:63495:-1 gene:ENSEEUG00000000534 transcript:ENSEEUT00000000533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQKVTGGIKTVDMRDPLYRPLKQELQDLDYCKPTRLDLLLDMPPVSYDIQLRHSWNNND
RSLNVFVKEDDKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQITWAMRQRGTHAVVGVATA
DAPLHSVGYTTLVGNNHESWGWDLGRNRLYHDGKNQPSKTYPAFLEPDETFIVPDSFLVA
LDMDDGTLSFIVDGQYMGVAFRGLKGKKLYPVVSAVWGHCEIRMCYLNGLDPEPLPLMDL
CRRSVRLALGKERLGDIHTLPLPASLKAYLLYQ
Download sequence
Identical sequences A0A1S3AFL7
ENSEEUP00000000471 XP_007534219.1.11023 ENSEEUP00000000471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]