SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000000495 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000000495
Domain Number 1 Region: 761-1016
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.07e-68
Family Eukaryotic proteases 0.0000006
Further Details:      
 
Domain Number 2 Region: 390-500
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.11e-20
Family MAM domain 0.013
Further Details:      
 
Domain Number 3 Region: 52-165
Classification Level Classification E-value
Superfamily SEA domain 1.44e-17
Family SEA domain 0.0084
Further Details:      
 
Domain Number 4 Region: 550-631
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-16
Family Spermadhesin, CUB domain 0.0025
Further Details:      
 
Domain Number 5 Region: 221-290
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000124
Family Spermadhesin, CUB domain 0.0033
Further Details:      
 
Domain Number 6 Region: 639-675
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 7 Region: 183-221
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000537
Family LDL receptor-like module 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000000495   Gene: ENSEEUG00000000562   Transcript: ENSEEUT00000000565
Sequence length 1017
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_5444:228628:431225:-1 gene:ENSEEUG00000000562 transcript:ENSEEUT00000000565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSKRKMPSRHDSLSTFEVMFAALFTMLVLVCAGLIAVAWLAMEGLEGDAESEKRHETRG
TFKITSGATYNPNLQDKLSVDFKVLAFDLQQMIDEIFQSSNLKNEYKNSRVSKFENGSVI
VLFDLFFDHWVSDENVKEELIQGIEANKSSQLVTFHVDLSSINITXXXXXXXXXXXXXNV
SIECLPGLRLCIDALHCIAIDLFCDGELNCPDGSDEDNTVCATACDGRFLLTGFSGTFQA
AFYPKPKSSVCQWIIRVNQGLSIELRFNSFNIFYTDVLNIYEGVGTSKILRXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXYYISTPTGPGGRRERVGLLSLPLHPTLEPVC
LSFWYFMYGEKVYKLSVNISSDQNKEKTVFQKEGNYGDNWNYGQITLNETVDFKVVFSAF
KNQIQSDIALDDISLTQGICNVSLYPEPTLVPTPPPELPXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXIWYLNSQEGKNIQLHFQEFELENIADVVEIRDGKGDNSLFLDVYTGSGPV
KDVFSTTNKMTVLFITDTELAKGGFKANFSTGYHLGISESCKEDNFQCKNGECVPLVNLC
DGFLHCVDGSDEKHCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
SGNSSVPVFSTGGGPFVNLNTAPNGSLILTSSKQCLQDSLILLQCNQKPCGKKLIAKGDR
PKISGGNDAKEGAWPWLTALYYNNQLLCGASLVSKDWLVSAAHCVYGRNLQPSRWKAALG
LHKASNMASPHTVTRLIDQIIINPHYNRRIKDSDIVMMHLEFNVNFTXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXPTADILQEAEVPLVSNEKCQQQMPEYNITENMMCAGYEEG
GIDSCKGDSGGPLMCQENNRWFLAGVTSYGYECARPRRPGVYVRVRRFTEWIQSFLN
Download sequence
Identical sequences ENSEEUP00000000495 ENSEEUP00000000495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]