SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000000511 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000000511
Domain Number 1 Region: 160-487
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.33e-140
Family Myotubularin-like phosphatases 0.000000000212
Further Details:      
 
Domain Number 2 Region: 35-156
Classification Level Classification E-value
Superfamily PH domain-like 3.2e-31
Family GRAM domain 0.0000611
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000000511   Gene: ENSEEUG00000000584   Transcript: ENSEEUT00000000584
Sequence length 490
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_9034:48235:115909:1 gene:ENSEEUG00000000584 transcript:ENSEEUT00000000584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASAPTSKYNSHSLENESVKRTSRDGVTQDLDEAVPRLPGETRITDKEVIYICPFNGPIK
GRVYITNYRLYLRSLETDSTLILDVPLGVISRIEKIGEXXXXXXXXXXXXXXXXXDMRNL
RFALKQEGHSRRDMFETLMRYAFPLTHSLPIFAFANEEKFNVDGWMVYNPVEEYRRQGLP
NHHWRITFINKFYELCDTYPPLLVVPYRASDEDLRRVAAFRSRNRIPVLSWIHPENKTVI
MRCSQPLVGMSGKRNKDDEKYLDVIRETNRQISKLTIYDARPSVNAVANKATGGGYESED
AYPNAELFFLDIHNIHVMRESLKKVKDIVYPNVEESHWLSSLESTHWLEHIKALVLTGAI
QVADRVSSGKSSVLVHCSDGWDRTAQLTSLAMLMLDSYYRSIEGFEILVQKEWISFGHKF
ASRIGHGDKNHADADRSPIFLQFIDCVWQMSKQFPTAFEFNERFLMTILDHLYSCRFGTF
LYNCEVREKQ
Download sequence
Identical sequences ENSEEUP00000000511 ENSEEUP00000000511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]