SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000000634 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000000634
Domain Number 1 Region: 689-913
Classification Level Classification E-value
Superfamily BEACH domain 1.22e-60
Family BEACH domain 0.00000221
Further Details:      
 
Domain Number 2 Region: 1042-1148,1184-1273
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.33e-22
Family WD40-repeat 0.0047
Further Details:      
 
Domain Number 3 Region: 613-689
Classification Level Classification E-value
Superfamily PH domain-like 5.29e-20
Family PreBEACH PH-like domain 0.0079
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000000634
Domain Number - Region: 952-984
Classification Level Classification E-value
Superfamily BEACH domain 0.0017
Family BEACH domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000000634   Gene: ENSEEUG00000000716   Transcript: ENSEEUT00000000716
Sequence length 1311
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_4726:4701:107574:1 gene:ENSEEUG00000000716 transcript:ENSEEUT00000000716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKDNDKDVPNEDIKRNFDEKTDEEKSSFASAHVSSDQWSLEDRQSLDSNIPLFQEDSSVG
ELSFKSENQEEFWPNNHSHLSLDLSGVDSCEISDSGSQIPDSLPSTPSPIESTKPFSVPS
DKESSITSEMDLSDDFFLLESQEKCEEELLLLTSILNYVMCKGLEKSDEETWIERGQVFS
ALTKPGISSELLRPSDEIKLNLLQKMLEWAVMENREAKMNPVTAENAFRLMLIIQDFLQS
EGLINSSMWTEKLLEDMILLFDGLSVWYSESPQWIKLSQIQIQLLLGFIERGNLQXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXEFFVVPFNRKARQENSRYNNVLKQLSSQHLATL
RCWKAVLLYLQCERGPWAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXIQHSQPSSESLLLEVVKQVKVNEMEEDKLDLPEEELSVKESXXXXXXXXXXXXXXXXX
XXXXXXXXXXXPRLAITTQHVYFHDGSTEKEDGVGFDFKWPHSQIREIHLRRYNLRRSAL
EIFHVDQSNYFLNFKKEVRNKVYTRLLSLHSPNSYGTRSPQELFKASGLTQKWVNREISN
FDYLIQINTMAGRTYNDLAQYPVFPWILQDYTSEELDLNNPSVFRDLSKPIGVVNDKNAK
AMREKYENFEDPMGTIDKFHYGTHYSNSAGVMHYLIRTEPFTTLHIQLQSGXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNLGRLQVSREVVNDVILPKWAKS
ADDFIYKHRKALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAVDLDALT
DKKERKALEGMINNFGQTPCQLLKVTVSLNYVIGTHGWLPYDREISNYFTFFKDQTVTNP
KTQRTMNSPFAPGLKITSRLFIVSQDAKLLFSGGHWDNSIQVMSLTKGKVISHNIRHMDI
VTCLATDYCGLHLISGSKDTTCMIWQITQQGGVPVGLASKPFQILYGHTDEVLSVGISTE
LDMAVSGSKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDKNALHLFSINGKYLGS
QTLTEQVSDICIVGEHIVMGSSQGYLSIRDLYSLNLSINPLFMRLPIHCVCVTKESSHIL
VGLEDGKLIVVGVGKPAEARPGQLSRKFWGSSKRFSQVSAGETEYNTQDFK
Download sequence
Identical sequences ENSEEUP00000000634 ENSEEUP00000000634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]