SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000000681 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000000681
Domain Number 1 Region: 6-136
Classification Level Classification E-value
Superfamily PX domain 8.76e-26
Family PX domain 0.00069
Further Details:      
 
Domain Number 2 Region: 229-282
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000643
Family SH3-domain 0.0025
Further Details:      
 
Domain Number 3 Region: 156-211
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000109
Family SH3-domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000000681   Gene: ENSEEUG00000000767   Transcript: ENSEEUT00000000767
Sequence length 358
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_7798:23360:25031:-1 gene:ENSEEUG00000000767 transcript:ENSEEUT00000000767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPPHPVSVHPAALVQTEHLQVFSFYVRWSDGGETLVHKSWDEFRGLHKTLKETFPVEA
GLLRRSDRVLPKFPGAPLLLLRGRMGRSLERLQRLGTYLLALLAAESLSRSPALGGFFAP
TSQDLESALSPGSLVILPVPTEAVASPRACSLEGGSLRCLHPYSTQDARGRLFRSGAGEV
LDVLLRHPSGWWLVANEEQQMAWFPAPYLEQAAGQGPKGGQLWGCRASQFCVSRAYNSGH
SDELSVPAGARVCVLETSDRGWWWCRYGECEGLLPAALLRPDQLGVLLSPAALFRSACHE
DEGESRAPEELPPSVPARPSPGAVRRSCCTITRRALGRSSQPLESTHGRGGQVPVPRE
Download sequence
Identical sequences ENSEEUP00000000681 ENSEEUP00000000681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]