SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000000717 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000000717
Domain Number 1 Region: 298-407
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.57e-25
Family Protein kinases, catalytic subunit 0.0000204
Further Details:      
 
Domain Number 2 Region: 455-515
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000000000703
Family Protein kinases, catalytic subunit 0.00041
Further Details:      
 
Domain Number 3 Region: 2-29
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000436
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.023
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000000717
Domain Number - Region: 76-99
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0129
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000000717   Gene: ENSEEUG00000000806   Transcript: ENSEEUT00000000806
Sequence length 615
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_6500:3981:125404:1 gene:ENSEEUG00000000806 transcript:ENSEEUT00000000806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIEREVLIVVXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFKLLSQEEGEYFNVPVPPEGSEGN
EELRQKFEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVML
SERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYF
VMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIIAYQPYGKSVDWWAFGVLLYEMLAGQ
APFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXCGRNAENFDRFFTRHPPVLTPPDQEVIRNIDQSEFEG
FSFVNNEFLKPEAKS
Download sequence
Identical sequences ENSEEUP00000000717 ENSEEUP00000000717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]