SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000000720 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000000720
Domain Number 1 Region: 13-89
Classification Level Classification E-value
Superfamily EF-hand 6.77e-22
Family Calmodulin-like 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000000720   Gene: ENSEEUG00000000809   Transcript: ENSEEUT00000000809
Sequence length 96
Comment pep:known_by_projection scaffold:HEDGEHOG:scaffold_283276:682:1106:-1 gene:ENSEEUG00000000809 transcript:ENSEEUT00000000809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KGFLDCTGFLVLMVIYWQKAQNQKGELRAAFRVFDKEGKGCIDWDMLKYVLTNTGKPLDE
VEAEQMMKEADKNRDGTTDYEEFMVMMTRESFKLAQ
Download sequence
Identical sequences ENSEEUP00000000720 ENSEEUP00000000720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]