SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000000724 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000000724
Domain Number 1 Region: 40-104
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000109
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000000724   Gene: ENSEEUG00000000814   Transcript: ENSEEUT00000000814
Sequence length 342
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_618:846:15543:-1 gene:ENSEEUG00000000814 transcript:ENSEEUT00000000814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAEPELIELRELAPARRPGLGRTRLERTNALRIPPGPARNHAQQRGRGHRFQPAGPATH
TWCDLCGDFIWGVVRKGLQCARLPADCRFTCHYRCRALVSLDCCGPRDLGWEPALERDTN
VDEPVQWETPDLSQAEIEQKIKEYNGQINSNLFMSLXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWDAFSL
PELHNFLRILQREEEEHLRQILQKYSYCRQKIQEALRACPLG
Download sequence
Identical sequences ENSEEUP00000000724 ENSEEUP00000000724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]