SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000000787 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000000787
Domain Number 1 Region: 114-257
Classification Level Classification E-value
Superfamily SH2 domain 6.19e-41
Family SH2 domain 0.0000398
Further Details:      
 
Domain Number 2 Region: 215-326
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.48e-26
Family Protein kinases, catalytic subunit 0.0000527
Further Details:      
 
Domain Number 3 Region: 34-162
Classification Level Classification E-value
Superfamily SH3-domain 7.22e-24
Family SH3-domain 0.00036
Further Details:      
 
Domain Number 4 Region: 390-445
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000000000107
Family Protein kinases, catalytic subunit 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000000787   Gene: ENSEEUG00000000884   Transcript: ENSEEUT00000000883
Sequence length 446
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_2253:148735:198555:-1 gene:ENSEEUG00000000884 transcript:ENSEEUT00000000883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYVCLRLWIYMKPCLPCLFQEEDSSTVIKNPVARWSCDEPLSQNHNHYFVALFDYQART
AEDLSFHAGDKLQVLDTSHEGWWLARHLEERAVGSSQQLQGYIPSNYVAEDRSLQAEPWF
FGAIKRADAEKQLLHRQNENGAFLVRESESQKGDFSLSVLDRGVVKHYRIRRLDDGGFFL
TRRKIFSTLNEFVSHYTKTSDGLCIKLEKPCLKIQVPAPFDLSYQTVDQWEIDRNSVQLL
KRLGSGQFGEVWEGLWNNTTPVAVKTLKPGSMDSNDFLREAQLMKKLRHPKLIQLYAVCT
LEEPIYIITELMRYGSLQEYLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXVDNEDIYESKHEIKLPIKWTAPEAILTNKFSIKSDVW
SFGILLYEIMTYGKTPYSGMTSAQVI
Download sequence
Identical sequences ENSEEUP00000000787 ENSEEUP00000000787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]