SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000000863 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000000863
Domain Number 1 Region: 132-172
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000000215
Family SH2 domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000000863   Gene: ENSEEUG00000000966   Transcript: ENSEEUT00000000965
Sequence length 173
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_1783:3049:6899:1 gene:ENSEEUG00000000966 transcript:ENSEEUT00000000965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PEADTEYSDPYDAHPVPPVADGGYVGPYDAQPVASELPGRSMQLYDTPYEQQDRGPEGVP
RNARRLPREDERPADEYDQPWEWKKESISKAFAXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXWFHGPLSRADAENLLSLCKEGSYLVRLSETSQDCSLSL
Download sequence
Identical sequences ENSEEUP00000000863 ENSEEUP00000000863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]