SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000000953 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000000953
Domain Number 1 Region: 15-107
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.67e-26
Family FCH domain 0.02
Further Details:      
 
Domain Number 2 Region: 151-259
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.28e-24
Family FCH domain 0.01
Further Details:      
 
Domain Number 3 Region: 402-485
Classification Level Classification E-value
Superfamily SH3-domain 2.23e-19
Family SH3-domain 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000000953   Gene: ENSEEUG00000001067   Transcript: ENSEEUT00000001065
Sequence length 486
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_1337:7880:83104:-1 gene:ENSEEUG00000001067 transcript:ENSEEUT00000001065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVTYDDSVGVEVSSDSFWEVGNYKRTVKRIDDGHRLCSDLMNCLHERARIEKAYAQQLT
EWARRWRQLVEKGPQYGTVERAWMAFMSEAERVSDLHLEVKASLMNEDXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVEAAKKAYHAACKEEKLAISRETNSKADP
SLNPEQLKKLQDKVEKCKQDVLKTKDKYEKSLKELDQTTPQYMENMEQVFEQCQQFEEKR
LRFFREVLLEVQKHLDLSNVSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXEWSADLNRTLSRREKKKAADGVTLTGINQTGDQTLQNKPSSDLSIPSNPARSAQSLSS
YNPFEDEDDTGSIVSEKEDIKAKNVSSYEKTQSYPTDWSDDESNNPFSSTDANGDSNPFD
EDATSGMEVRVRALYDYEGQECDELSFKAGDELTKIEDEDEQGWCKGRLDSGKIGLYPAN
YVEDIQ
Download sequence
Identical sequences ENSEEUP00000000953 ENSEEUP00000000953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]