SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000001027 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000001027
Domain Number 1 Region: 41-166
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 4.58e-50
Family N-terminal domain of cbl (N-cbl) 0.00000252
Further Details:      
 
Domain Number 2 Region: 255-327
Classification Level Classification E-value
Superfamily SH2 domain 6.91e-39
Family SH2 domain 0.0000127
Further Details:      
 
Domain Number 3 Region: 401-425
Classification Level Classification E-value
Superfamily RING/U-box 0.00000812
Family RING finger domain, C3HC4 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000001027
Domain Number - Region: 925-967
Classification Level Classification E-value
Superfamily UBA-like 0.000172
Family UBA domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000001027   Gene: ENSEEUG00000001141   Transcript: ENSEEUT00000001144
Sequence length 980
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_2459:1883:300859:-1 gene:ENSEEUG00000001141 transcript:ENSEEUT00000001144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANSLNGRNPGGRGGNPRKGRILGIIDAIQDAVGPPKQAAADRRTVEKTWKLMDKVVRLC
QNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKR
AIRLFKEGKERMYEEQSQDSNLAKLSLFLSHMLAEIKAIFPNGQFQIDNFSITKADGAEF
WRKFLGDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
PWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYVT
GDGNILQTIPHNKPLFQALIDGSREGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXESDGQGCPFCRCEIKGTEPI
IVDPFDPRDEGSRCCSIIDPFGMPMLDLDDDDDREESLMMNRLANVRKCTERQNSPVTSP
GSSPLAQRRKPHPNPLQIPHLSLPPVPPRLDLIHKGIVRSPCGSPTGSPKSSPCMVRKQD
KPLPAPPPPLRDPPPPPPESPPPIPPENRLSRPLHHVESVPSRDQPMPLEAWCPRDVFGT
NLVGCRLLGEGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVFSNGHLGN
EEYDVPPRLSPPPPAAALLPSIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXSCDNGHCILNGTLGTASEMKKSNIPELGIYLKGDVFESASVPVPLPPA
RPPTRDNPKHGSSLNRTPSDYDLLIPPLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXPFLFGPDNAVSLPLARRLSSNIKSNRVPQTYNQLPSPSDGSQAP
ARPPKPRPRRTAPEIHHRKPQVPEAALENVDAKIAKLMGEGYAFEEVKRALEIAQNNVEV
ARSILREFAFPPPVSPRLNL
Download sequence
Identical sequences ENSEEUP00000001027 ENSEEUP00000001027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]