SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000001139 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000001139
Domain Number 1 Region: 73-258
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.92e-49
Family Astacin 0.00035
Further Details:      
 
Domain Number 2 Region: 428-594
Classification Level Classification E-value
Superfamily TRAF domain-like 1.62e-38
Family MATH domain 0.0012
Further Details:      
 
Domain Number 3 Region: 267-429
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.32e-26
Family MAM domain 0.0085
Further Details:      
 
Domain Number 4 Region: 671-713
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000112
Family EGF-type module 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000001139   Gene: ENSEEUG00000001267   Transcript: ENSEEUT00000001270
Sequence length 745
Comment pep:known_by_projection scaffold:HEDGEHOG:scaffold_340302:4191:55281:1 gene:ENSEEUG00000001267 transcript:ENSEEUT00000001270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSTRSTCILSILFFAHIAAVSIKNFPKNNVNDAEFDEQKDISEINLAAGLDLFQGDILL
RNSKNGLRDPTTRWKFPIPYILADNLELNAKGAILYAFEMFRLRSCVDFKPYEGESSYII
FQKFDGCWSEVGDQHVGQNLSIGSRCDYKAIIQHEILHALGFYHEQSRTDRDDYVDIWWD
EILSGHQHNFNTYDDNFITDLNTPYDYESLMHYAPFSFNKNESVPTITTKIPEFNSIIGQ
RLDFSAVDLERLNRMYNCTATHTLLDHCAFEKTNICGMIQGTRDDANWVHEDSTADETDS
TLLGKCTGAGYFMHFSTSSGTAEEAALLESRILYPKRKQQCLQFFYKMTGSPSDRLVIWV
RRDDSTGNVRKLFKVATFQGSEDQDWKIAHVTLREEKKFRYLFQGTKGDPQNSNGGIYLD
DITLTETPCPTGVWTVRNYSQVLQNTVKGDRILSPPFCNSEGYCFGLTLYPHGRPEYSSS
DYTGLSFHLCSGENDAILEWPVENRQAIMTILDQEPNAMNRMSASMAFTTSKSHTTVNGS
VIWDRPSLVGSYESSCNCYRNPDWGWTNFISHQWLGRRSFLKNDDLIMFVDFEXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVPEEVLPGSLIQENPRRQKRSVENTGPM
EDHNWPQYFRDPCDPNPCQNEGICVNVKGMASCRCVSSHAFFYTGERCQAMQVHSSILGL
MIGGTAGVIFLTFTIISIISQRPRQ
Download sequence
Identical sequences ENSEEUP00000001139 ENSEEUP00000001139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]