SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000001140 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000001140
Domain Number 1 Region: 1-124
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 6.28e-39
Family Transcription factor STAT-4 N-domain 0.00041
Further Details:      
 
Domain Number 2 Region: 491-584
Classification Level Classification E-value
Superfamily p53-like transcription factors 4.72e-31
Family STAT DNA-binding domain 0.00048
Further Details:      
 
Domain Number 3 Region: 330-420
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.57e-25
Family STAT DNA-binding domain 0.012
Further Details:      
 
Domain Number 4 Region: 585-636
Classification Level Classification E-value
Superfamily SH2 domain 1.16e-18
Family SH2 domain 0.00088
Further Details:      
 
Domain Number 5 Region: 136-184
Classification Level Classification E-value
Superfamily STAT 0.000000000353
Family STAT 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000001140   Gene: ENSEEUG00000001270   Transcript: ENSEEUT00000001271
Sequence length 787
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_7206:6233:35040:-1 gene:ENSEEUG00000001270 transcript:ENSEEUT00000001271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVWIQAQQLQGDALHQMQALYGQHFPIEVRHYLSQWIESQAWDSIDLDNPQENIKATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGTSPAGRLADAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNS
SSSHLEDYNSMSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKAVDGYVKPQIKQVVPEFVNASADSAG
GSTTYMDQAPSPAVCPQTHYNIFPQNPDPVLDTDGDFDLDDTMDVARRVEELLGRPMDSQ
WIPHAQS
Download sequence
Identical sequences ENSEEUP00000001140 ENSEEUP00000001140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]