SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000001144 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000001144
Domain Number 1 Region: 135-254
Classification Level Classification E-value
Superfamily EF-hand 3.63e-35
Family Osteonectin 0.023
Further Details:      
 
Domain Number 2 Region: 223-318
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.44e-27
Family Thyroglobulin type-1 domain 0.00085
Further Details:      
 
Domain Number 3 Region: 72-118
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000115
Family Ovomucoid domain III-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000001144   Gene: ENSEEUG00000001278   Transcript: ENSEEUT00000001276
Sequence length 377
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_5273:19293:187863:-1 gene:ENSEEUG00000001278 transcript:ENSEEUT00000001276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DDYFRNWNPSKPFDQDPSKDPCLKVKCSPHKVCVTQDYQTALCVSRKHLLPRQKKWTVAH
KHWVGPSNLVKCKPCPVTQSPLAMVCGSDGHTYTSKCKLEFHACSANKALTTLCDGPCPC
LPEPEPPKHKAEKSACTDKELRNLASRLKDWFGALHEDANRVIKPTSSDTAQGRFDTSIL
PICKDSLGWMFNKLDMNYDLLLDHSEINAIYLDKYEPCIKPLFNSCDSFKDGKLSNNEWC
YCFQKPGGLPCQNEMNRIQKLSKGKSLLGAFIPRCNEEGYYKATQCHGSTGQCWCVDKYG
NELAGSRKQGAVSCEEEQETSGDFGSGGSVVLLDDLEDEQELGPKNRLGKLRVHARAVRE
DDEDEDDDKEDEIGYIW
Download sequence
Identical sequences ENSEEUP00000001144 ENSEEUP00000001144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]