SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000001180 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000001180
Domain Number 1 Region: 270-448
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.31e-68
Family SPRY domain 0.00000721
Further Details:      
 
Domain Number 2 Region: 3-99
Classification Level Classification E-value
Superfamily Immunoglobulin 1.43e-19
Family V set domains (antibody variable domain-like) 0.00025
Further Details:      
 
Domain Number 3 Region: 114-190
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000812
Family C1 set domains (antibody constant domain-like) 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000001180   Gene: ENSEEUG00000001318   Transcript: ENSEEUT00000001315
Sequence length 475
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_3162:5300:12582:1 gene:ENSEEUG00000001318 transcript:ENSEEUT00000001315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSVKRPAEPIMVLLGTDATLPCQLSPEQSAAHMQIRWYRSQGSPAVLVYQNGQELGGEQM
LEYRGRTELVADSIGKGAVALLIQQVRASDDGQYWCHFKDLGSIPFIEIKGHDDGGIRLE
CKSLGWFPEPHAVWKDPYGEIMPSLEEAYTMDADGLFKVTIAIIIRDCTVRNMSCSINNT
LLGQEKETVIFIPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXQLQELRWRRTLLHAADVILDPDTAHPELFLSEDLRSV
KRGSYRQSVPDNPERFDCRPCVLGLESFSSGKHYWEVEVESVMVWAVGVCRDNVERKGEA
LLVPENGFWTLEMFGNQYRVLSSPEKILPLKECLRRVAVFLDYESGDISFYNMRDRSHIY
TCPHSLFSGPLRPFFRLGSDDSPLFICPAFTGAKGLTVPEAGLILHRAGTHCCQS
Download sequence
Identical sequences ENSEEUP00000001180 ENSEEUP00000001180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]