SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000001181 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000001181
Domain Number 1 Region: 100-313
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.22e-61
Family DBL homology domain (DH-domain) 0.0000219
Further Details:      
 
Domain Number 2 Region: 298-423
Classification Level Classification E-value
Superfamily PH domain-like 4.11e-31
Family Pleckstrin-homology domain (PH domain) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000001181   Gene: ENSEEUG00000001313   Transcript: ENSEEUT00000001316
Sequence length 1389
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_2898:44692:159715:1 gene:ENSEEUG00000001313 transcript:ENSEEUT00000001316 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELSDSDRPVSFGSTSSSASSRDSHGSFGSRMTLVSSSHLGFFPQDKEAGAIKLELVPAR
PFSSNELRRDAAGQPDVEEGASSRQPRASWRVDTNGTSKPGAESAASPKLLYVDRVVQEI
LETERTYVQDLKSIVEDYLDCIKDQAKLPLGLEERTALFGNIQDIYHFNSELLQDLKNCE
NDPVAIAECFVSKSEEFHIYTQYCTNYPRSVAVLTECMRNKILAKFFRERQETLKHSLPL
GSYLLKPVQRILKYHLLLHELENHLHKDTEGYDVVLEAIDTMQRVAWHINDMKRKHEHAV
RLQEIQSLLTNWKGPDLTSYGELVLEGTFRLQRAKNERTLFLFDKLLLITKKRDDTFTYK
AHILCGNLMLVEVIPKEPLSFSVFHYKNPKLQHTVQAKSQQDKRLWVLHLKRLILENHAA
KIPAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSSRSHKVLKT
SETIQDIQKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTRESTPVLSRDTAHALSTLSLPESPA
FLTPLKTRPGRAGQTHCPLEEDLLSEEGSFLSLNRLSLASEIPAMENPYDLANNSLSQSD
LETPDLGLEATDKTKSKVFMMARQYSQKIKKANQLLKVKSSELEQPPSSQQHRASMHKDL
AAILEEKKQGGPAIGARIAEYSQLYDQIVFREPPFKTQKDGWPNPPESSPLHPISPSQAP
PGNEDWFLNSTYSNGELADFCPQPAEQDLKSKYPTLEMNMKSTPRQLSTACSVPSLQTPD
PLLSSVQRRSVIVSQPSKEYSCQSHLYNSLGRKGISVKPQPYSRSQSSSSILINKSGDSI
SYPSEMTKSQQLPLHPSSRAGSHQDLLSSMAVSCPRGTEKCSDLTLQDSQKVLVINRNVP
LSAQIATQNYFSNFKETEGDEDDYVEIKSEEEESELELSHGHRKRCDPKMVGAGLSENVC
SDSPPSSLNSPCTVKKPMGSKLGLSPYLTPCNDSDKLNDYLWRGPSPSQQNLVQSLREKF
QCLSSSSFA
Download sequence
Identical sequences ENSEEUP00000001181 ENSEEUP00000001181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]