SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000001410 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000001410
Domain Number 1 Region: 950-1126
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.81e-45
Family BCR-homology GTPase activation domain (BH-domain) 0.00029
Further Details:      
 
Domain Number 2 Region: 271-404
Classification Level Classification E-value
Superfamily PH domain-like 1.85e-27
Family Pleckstrin-homology domain (PH domain) 0.00085
Further Details:      
 
Domain Number 3 Region: 661-832
Classification Level Classification E-value
Superfamily PH domain-like 2e-27
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 
Domain Number 4 Region: 9-64
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000785
Family SAM (sterile alpha motif) domain 0.0085
Further Details:      
 
Domain Number 5 Region: 560-635
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 0.00000000000314
Family Pyk2-associated protein beta ARF-GAP domain 0.0024
Further Details:      
 
Domain Number 6 Region: 1260-1368
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000166
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 
Domain Number 7 Region: 850-976
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000588
Family Pleckstrin-homology domain (PH domain) 0.0095
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000001410
Domain Number - Region: 1161-1236
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00568
Family Ras-binding domain, RBD 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000001410   Gene: ENSEEUG00000001532   Transcript: ENSEEUT00000001555
Sequence length 1423
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_8037:135447:175008:-1 gene:ENSEEUG00000001532 transcript:ENSEEUT00000001555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAGDAALSVAEWLRALHLEQYTGLFEQHGLVWASECQGLSDARLLNMGVQLPGHRRRV
LAGLLRAHAAPAPAPRPSSRPVPMKRHVFRSPPTSATTPQMPSTVGEAEGLLPAPPIPPR
RSCLPPTCFSALTTTTSEPMLPPLPAKRHLAESSLPPVPPRTAPPRLLVSLPSKEEELLS
LPLSSPPQPAEPSPPPSPPKPPKPVRQVPEFDDSDYDEAPKERLGLPAGVMTKKEELSAS
LVPRAVRVASLLSEGEELSGDDQGDEDESDPAYEGVPNGGWHTSSLSSSLPSTAPPYPMD
GLAGGPRPAAPVIKAGWLDKNPPQGSYIYQKRWVRLDSDYLRYFDSNKDAYSKRFVSVAC
ISRVAAIGDQKFEVITNNRTFAFRAESDAERKEWIQALQQAVAEQRARARLSSAHPLGIC
GPELPDRSGSLELRGFKNKLYVVVVGDKVQLYKNLEXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXEHRGLGAAISKVRSLKMDRKVWTETLIELFLQLGNGAGNRF
WAANVPPSEALQPGSSPGARRRHLEAKYREGKYRRYHLLFGNQEELDKALCAAVTTTDLA
ETQALLGCGAGVNCFSGDPEAPTPLALAEQAGQMLQMEFLRNNRSTEVPRLDPVKPLEKH
YSVILPTVSHSGFLYKTASAGKLLQDRRAREEFSRRWCVLSDGVLSYYENERTVTPNGEI
RASEIVCLAVPPPETHGFEHTFEVYTEGERLYLFGLESAELAREWVKCIAKAFVPPLAED
LLARDFERLGRLPYKAGLSLQCAREGWFSLTGSELRAVFSEGPCEEPLQLRKLQELSIQG
DSENQVLVLVERRRTLYIQGERRLDFTGWLGAIQKAAASSGDTLSEQQLGDSDIPVIVYR
CVDYITQCGLTSEGIYRKCGQTSKTQRLLESLRQDARSVRLKEGEQHVDDVSSALKRFLR
DLPDGLFTRAQRLAWLEASEVEGEEKVSRYRELLTRLPPVNRATVKALISHLYCVQCFSD
TNQMNTHNLAIVFGPTLFQTDGQDYKAGRVVEDLISHYVAVFSVDEEELRKQREEITAIV
KMRVAGTASGTQHAGDFICTVYLEEKKAEAEQHIKIPASMTAQELTLEILDRRNVGIREK
DYWTCFEVNEREEAERPLHFAEKVLPILHGLGVDSYLVVKKQQSMEAMLLYLASHVGDTK
HGMMKFREDRSLLGLGLPSGGFHDRYFILNSSCLRLYKEIRSHRPEKEWPXXXXXXXXXX
XXXXXXXXXWGFTVVHETEKHEKQQWYLCCETQMELREWFATFLFVQHNGMVWPSEPSRV
SGTVPDVSRLGSVSLIPLRGNETEMRRSVAAFTSDPLSLLRNV
Download sequence
Identical sequences ENSEEUP00000001410 ENSEEUP00000001410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]