SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000001425 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000001425
Domain Number 1 Region: 523-636
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000016
Family Pleckstrin-homology domain (PH domain) 0.033
Further Details:      
 
Domain Number 2 Region: 65-249
Classification Level Classification E-value
Superfamily ARM repeat 0.000000202
Family HspBP1 domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000001425   Gene: ENSEEUG00000001571   Transcript: ENSEEUT00000001571
Sequence length 636
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_916:49618:98810:-1 gene:ENSEEUG00000001571 transcript:ENSEEUT00000001571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQLLEIDQKRPLASIIKEVCDGWSLPNPEYYTLRYADGPQFYITEQTRSDIKNGTILQLA
ISPSRAARQLMERIQSSNMETRLDAMKELAKLSADVTFATEFINMDGIVVLTRLVESGTK
LLSHYSEMLAFTLTAFLELMDHGIVSWDMVSITFIKQIAGYVSQPMVDVSILQRSLAILE
SMVLNSQSLYQKIAEEITVGQLISHLQVXXXXXQTYAIALINALFLKAPEDKRQDMANAF
AQKHLRSIILNHVIRGNRPIKTEMAHQLYVLQVLTFNLLEERMMTKMDPNDQAQRDIIFE
LRRIAFDAESDPSNVPGSGTEKRKAMYTKDYKMLGFTNHINPAMDFTQTPPGMLALDNML
YLAKFHQDTYIRIVLENSSREDKHECPFGRSAIELTKMLCEILQVGELPNEGRNDYHPMF
FTHDRAFEELFGICIQLLNKTWKEMRATAEDFNKVMQVVREQITRALPSKPNSLDQFKSK
LRSLSYSEILRLRQSERMSQDDFQSPPIVELREKIQPEILELIKQQRLNRLCEGSSFRKI
GNRRRQERFWYCRLALNHKVLHYGDLDDNPQGEVTFESLQEKIPVADIKAIVTGKDCPHM
KEKSALKQNKEVLELAFSILYDPDETLNFIAPNKYE
Download sequence
Identical sequences ENSEEUP00000001425 ENSEEUP00000001425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]