SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000001507 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000001507
Domain Number 1 Region: 250-517
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.63e-84
Family Protein kinases, catalytic subunit 0.000000000126
Further Details:      
 
Domain Number 2 Region: 81-166
Classification Level Classification E-value
Superfamily SH3-domain 7.84e-19
Family SH3-domain 0.000023
Further Details:      
 
Domain Number 3 Region: 138-263
Classification Level Classification E-value
Superfamily SH2 domain 2.83e-16
Family SH2 domain 0.0000233
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000001507   Gene: ENSEEUG00000001657   Transcript: ENSEEUT00000001658
Sequence length 925
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_1267:2641:61402:1 gene:ENSEEUG00000001657 transcript:ENSEEUT00000001658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQQPGKVLGDQRRPSLPALHFIKGTGKKDSSRHGGPHCNVFVEHEALQRPVASDFEPQG
LSEAARWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCE
AQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRN
KPTVYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVE
EFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLL
YMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKF
PIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERP
EGCPEKVYELMQACWQWNPSERPSFAEIHQAFETMFQESSISDEVEKELGKKGMRGVAST
LLQAPELPTKTRTSRKAAEHKDPTDVPETPHSKGLGETDPLDPEPTVSPLLPRKERGPQD
SILSEDERLLPKDKKTNLFSALIKKKKKTAPTPPKRSSSFREMDGQPERRGAGEDEVQGR
EISNGALALTPPDTAEPAKCPKPSSAAGVPNGAFREAGGAGFRSPHLWKKSSTLTSSRLA
ASEEESGGSASKRFLRSCSASCVPHGAKDTEWRSVTLPRDLQSTVRQFDSSTFGGHKSEK
PALPRKRANENRPDHMARGTVTPPPRLVKKTEEAADEVFKDAAESSPGSSPPNLTPKLLR
RQVVMVSSSGLPHKEETGKASASGIPAAETVPPTSRAGPGASGGASKPPSEDSRVRRHKP
SSESPGRDKGKLSKLKPAPPPPPPT
Download sequence
Identical sequences ENSEEUP00000001507 ENSEEUP00000001507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]