SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000001579 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000001579
Domain Number 1 Region: 3-143
Classification Level Classification E-value
Superfamily FKBP-like 2.43e-39
Family FKBP immunophilin/proline isomerase 0.00027
Further Details:      
 
Domain Number 2 Region: 138-244
Classification Level Classification E-value
Superfamily FKBP-like 3.54e-34
Family FKBP immunophilin/proline isomerase 0.00036
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000001579
Domain Number - Region: 299-324
Classification Level Classification E-value
Superfamily EF-hand 0.00157
Family Calmodulin-like 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000001579   Gene: ENSEEUG00000001740   Transcript: ENSEEUT00000001735
Sequence length 335
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_3037:1252:23938:1 gene:ENSEEUG00000001740 transcript:ENSEEUT00000001735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KDIPGQASLVFDVALLDLHNPKDGISIENKVIPEHCERQSQSGDFLRYHYNGTLLDGTFF
DSSYSRNRTFDTYIGQGYVIAGMDEGLLGVCIGEKRRIVVPPHLGYGEEGRGNIPGSAVL
VFDIHVIDFHNPSDSISITSHYKPPDCSVLSKKGDFLKYHYNASLLDGTLLDSTWNLGKT
YNIVLGSGQVVLGMDMGLREMCVGEKRTVIIPPHLGYGEAGVDGEVPGSAVLVFDIELLE
LVAGLPEGYMXXXXXXXXXXXXXXXXXXXXXXXXXXXFSEYIHAQVASGRGKLAPGFDAK
MIVKNMFTNQDRNADGKVTAEEFKLKDQEAKHDEL
Download sequence
Identical sequences ENSEEUP00000001579 ENSEEUP00000001579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]