SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000001689 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000001689
Domain Number 1 Region: 52-178
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.37e-43
Family Regulator of G-protein signaling, RGS 0.000000941
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000001689   Gene: ENSEEUG00000001854   Transcript: ENSEEUT00000001855
Sequence length 196
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_4609:6413:9997:-1 gene:ENSEEUG00000001854 transcript:ENSEEUT00000001855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCRTLSGFPTTCLERAKELKTRLGIFLHKSDRGCDIGGAGELSSHSKDNRNFSEDVLGWK
ESFDLLLSSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASQAHRIFEEFVR
CEAPKEVNIDHETRELTRTNLQAASATCFDVAQGKTRTLMEKDSYPRFLKSSAYRDLAAQ
AAATLPSRNTSEPSHT
Download sequence
Identical sequences ENSEEUP00000001689 ENSEEUP00000001689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]