SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000001723 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000001723
Domain Number 1 Region: 312-463
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.49e-26
Family MAM domain 0.0023
Further Details:      
 
Domain Number 2 Region: 142-271
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-20
Family MAM domain 0.0086
Further Details:      
 
Domain Number 3 Region: 1-142
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-19
Family MAM domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000001723   Gene: ENSEEUG00000001887   Transcript: ENSEEUT00000001894
Sequence length 633
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_6313:3648:179287:1 gene:ENSEEUG00000001887 transcript:ENSEEUT00000001894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CAFEENTCGFDSELFSQPWMLNEEGHYIYVDTSFAKQGEKAVLVSSDLQAEEWSCLRLVY
QITTSEGSPSNPSQLNLYVRFEDESFDRLLWSTKETSDSWLITSLDLQSSPKKFKILIEG
VLGQGATTSIALFEIKMTADYCIECDFEENHLCGFVNRWNPNVNWFVGGGNIRNSHSILP
HDHTFKSELGHYMYVDSVYVKHFQEVAQLISPMTTAPMSGCLSFYYQLQQGNDNAFSLYT
RDVTGLYEEIWKMDSPGNTVWNLAEVEFSAPYPMEXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXLSFSTLEASCDFEEDFCNFYQDKEGPGWTRVQGKPNIYRAGDHTSGLGYYLLA
NTKLTSQPGYMGRLYGPSLPGNLPYCLRFYYAIYGFFKMNDTLTVYLFEENHVIQEKIWS
VQESPRGIWLRAEITFQKPMSAKVVFLSLCKFWDCVALDDITELGSCSAAEKFPPPPGEC
TFEQDECAFTQEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXIIFEAIRGVSIRSDMAIDDVKFQAG
Download sequence
Identical sequences ENSEEUP00000001723 ENSEEUP00000001723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]