SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000001743 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000001743
Domain Number 1 Region: 2-180
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.95e-37
Family Lectin leg-like 0.0000603
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000001743   Gene: ENSEEUG00000001918   Transcript: ENSEEUT00000001915
Sequence length 340
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_4420:609:4843:1 gene:ENSEEUG00000001918 transcript:ENSEEUT00000001915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AILGPEELRLAPSLPGRRGAVWTRAPAPFLAWQVDVQLRVTGRGRWGAQGMAVWYSREGG
HGDSVLGGPATRDSIAVVLDSGSSQVGDSQGSPAIRLLAWDGHTASHQLGGGRELGSCHR
DFRNRPYPFRVRVTYWGQRLRVTLSSGLTAQDPEEDCFSVGPLALAPGLFGVSAATGNLA
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXDSTQAGALLRGQLSLLQHLRPL
Download sequence
Identical sequences ENSEEUP00000001743 ENSEEUP00000001743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]