SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000001786 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000001786
Domain Number 1 Region: 3-73
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 0.0000000000102
Family Pyk2-associated protein beta ARF-GAP domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000001786   Gene: ENSEEUG00000001958   Transcript: ENSEEUT00000001964
Sequence length 503
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_7205:9236:58568:1 gene:ENSEEUG00000001958 transcript:ENSEEUT00000001964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGLNPPHRVKSISMTTFTQQEIEFLQKHGNEVCKQIWLGLFDDRSSAIPDFRDPQKVKEF
LQEKYEKKRWYVPPEQAKVVASVHASISGSSASSTSSTPEVKPLKALLGDSAPALHLNKG
TPSQSPVVGRSQGQPQEKEQFDLFSDLGSDIFGGSALQSAARAFADLAHSNSHAAHSSAN
ADFANFDAFGQSSGSSNFGAFPTASHSPFQPQTTGGNAGSVNANFAHFDNFPKSSSADFG
TFSTSQSHQTASAVSKVSTNKAGLQTADKYAALANLDNIFSAGQGGDQGSGFGATGKPPV
GSVVSVPSQSSASSDKYAALAELDSVFSSAATSSNAYTSTSNASSSVFGTVPVGASAPTQ
PASSSVPAPFGATPSTNPFVAAGPSVASSTNPFQTHARGATAATFGTASMSMPAGFGAPA
PYSLPTSFSGSFQQPAFPAQAAFPQQTAFPQQPNXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXSGAPTGQFPGSSSTNPFL
Download sequence
Identical sequences ENSEEUP00000001786 ENSEEUP00000001786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]