SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000001790 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000001790
Domain Number 1 Region: 1148-1246
Classification Level Classification E-value
Superfamily PH domain-like 1.63e-24
Family Pleckstrin-homology domain (PH domain) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000001790   Gene: ENSEEUG00000001960   Transcript: ENSEEUT00000001968
Sequence length 1257
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_4765:1007:135384:1 gene:ENSEEUG00000001960 transcript:ENSEEUT00000001968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPSHPQKQLDLQNGSLDVSLVMNSLQNDSQNTMESLSPKKYSSSLRFKANGDYSGSYL
TLSQPVPPKRSPSPLGTSIRSSPSIAKIQGSKQLSCDGTDKSMPMKSPAPLLSTSLSLSG
YPHGRADFDHHTGRDSERSFRLSEKPPYSKYSSRNKSHDNVYFLGGLDGRKASGSLLAMW
NGSMMMNDTGPSPISRSGAASMPSSPKQARKMSIQDNLTLQPKLTRHKEPAFDSISLRSR
KYSGSSSLSHMGAYSRSLPRLYRATENQLTPLSLPPRSSLGNSKRTRLGDKDLPHNIIDN
DNYLNFSSLSSGALPYKTSASEGNPYASSTLSVPASPRVARKMLLASTSSCTSDDLDRAP
YLGNSPGQSFPHGELDRMFAARRNFSCGSVEFDDSDLDSLRQSSGTPQPVLRERKSSISS
ISGRDDLMDYHRRQREERLREQEMERLERQRLETILSLCAEYTKPDSLVSTGTTVADVQK
INKELEKLQLSDEESVFEEALVSPEVRYRCHQKGSLHDADLSAFGNLSQSNASFLSPRSI
RNDDLLRDLTRSPPPPSSAFLKASSESTYLSILPKTPEAISEEQKVQELAAMEESRIAIL
NNLEELEQKIKDINDQMDESSREXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXKVKLDAERELERLQELYSEQKTQLDNCPESMREQLQQQLKRDADLLDVES
KHFEDLEFQQLEHESRLDEEKENLTQQLLREVAEYQRNIVTRKEKISALKKQANHIVQQA
QREQDHFVKEKNNLIMMLQRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGYISVNEINE
PCGNSMNLSPSTQFPADADADAVATGPTTAVLVSQPQNKEHFRSLEERKKQHKEGLYLSD
TLPRKKTTSSISPHFSSATMGRSTAPKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XYNHQQMNEGQRQKSSEFYNRTASESNVYLNSFHYPDHSYKGQAFDTLSLDSSDSMETSI
SACSPDNISSASTSNIARIEEMERLLKQAHAEKTRLLESREREMEAKKRALEEEKRRREI
LEKRLQEETSQRQKLIEKEVKIREKQRAQARPLTRYLPVRKEDFDLRSHVETAGHNVDTC
YHVSITEKTCRGFLIKMGGKIKTWKKRWFVFDRNKRTFSYYADKHEAKLKGIIYFQAIEE
VYYDHLKNANKSPNPLLTFSVKTHDRIYYMVAPSPEAMRIWMDVIVTGAEGYTHFLL
Download sequence
Identical sequences ENSEEUP00000001790 ENSEEUP00000001790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]