SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000001857 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000001857
Domain Number 1 Region: 51-221
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.13e-58
Family Arfaptin, Rac-binding fragment 0.0000000605
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000001857   Gene: ENSEEUG00000002045   Transcript: ENSEEUT00000002039
Sequence length 221
Comment pep:known_by_projection scaffold:HEDGEHOG:scaffold_291066:7847:9291:-1 gene:ENSEEUG00000002045 transcript:ENSEEUT00000002039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HPSHSATPAGPGDEVARGIAGEKFDIVKKWGINTYKCTKQLLSERFGRGSRTVDLELELQ
IELLRETKRKYESVLQLGRALTAHLYSLLQTQHALGDAFADLSQKSPELQEEFGYNAETQ
KLLCKNGETLLGAVNFFVSSINTLVTKTMEDTLMTVKQYEAARLEYDAYRTDLEELSLGP
RDAGMRGRLESAQASFQAHRDKYEKLRGDVAIKLKFLEENK
Download sequence
Identical sequences ENSEEUP00000001857 ENSEEUP00000001857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]