SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000001906 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000001906
Domain Number 1 Region: 415-568
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.46e-35
Family Protein kinases, catalytic subunit 0.000000411
Further Details:      
 
Domain Number 2 Region: 90-142
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000284
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00037
Further Details:      
 
Domain Number 3 Region: 288-357
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000018
Family Protein kinases, catalytic subunit 0.00054
Further Details:      
 
Domain Number 4 Region: 20-88
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000331
Family Ras-binding domain, RBD 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000001906   Gene: ENSEEUG00000002090   Transcript: ENSEEUT00000002092
Sequence length 602
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_859:30993:62083:1 gene:ENSEEUG00000002090 transcript:ENSEEUT00000002092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPPRAAPSNGAEPSRTVGTVKVYLPNKQRTVVRESINVTNSLDSALKVGGLNXXXXXXX
XXXXXRKTVTAWDTAIAPLDGEELIVEVLEDVPLTMHNFVRKTFFSLVFCDFCLKFLFHG
FRCQTCGYKFHQHCSSKVPTVCVDMSTNRRQFYHSIQDLSGSSRQPEAPTNPLNELTPQG
PSSCTQHHSPEHFPFPAPTNTPLQRIRSTSTPNVHMVSTTTPMDSSLLQLTAPNFITDAA
AGRGGGDGAPRGSPSSTSMSSGRKSPHPKSPSEQRERKSLAEEKKKVKNLGHRDSGYYWE
VPPSEVQLMKRIGTGSFVIVYRGRWHGDVAVKVLKVAQPTAEQAQAFKNEMQVLRKTRXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYLHAKN
IIHRDLKSNSICLLGGLTVKIGDFGLATVKTRWSGAQPLEQPSGSVLWMAAEVIRMQDPN
PYSFQSDVYAYGVVLYELMTGSLPYSHIGSRDQIIFMVGRGYLSPDLSKISSNCPKAMRR
LLSDCLKFQRDERPLFPQILATIELLQRSLPKIERSASEPSLHRTQADELPACLLSAARL
VP
Download sequence
Identical sequences ENSEEUP00000001906 ENSEEUP00000001906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]