SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000001912 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000001912
Domain Number 1 Region: 43-117
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000047
Family Calmodulin-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000001912   Gene: ENSEEUG00000002102   Transcript: ENSEEUT00000002098
Sequence length 357
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_3456:1099:28845:-1 gene:ENSEEUG00000002102 transcript:ENSEEUT00000002098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTPDKPVVSSPQRPEQGHKSSGACPGPLGSLEWKESQELALEEAAMLRKVEEFFLICDT
EGKGFIARKDMQRLNQELPLSLEELQRVFDALDADGNGLLTLEEFTQGFSHFFFSQSQAD
HPEKVYQSMGDGLGDLDEDEEAQFQMLIDKLGAQKVLEXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGQQIQEKEQFLLTDTE
RFQAHCQELEQKLLCKEQELEQLVQKQKQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVYRVTESLQREKSGLLKQLELLRC
Download sequence
Identical sequences ENSEEUP00000001912 ENSEEUP00000001912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]