SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000001973 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000001973
Domain Number 1 Region: 207-319
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.36e-31
Family Regulator of G-protein signaling, RGS 0.00000861
Further Details:      
 
Domain Number 2 Region: 135-195
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.00000000000000103
Family Transducin (heterotrimeric G protein), gamma chain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000001973   Gene: ENSEEUG00000002164   Transcript: ENSEEUT00000002167
Sequence length 319
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_815:15018:21553:-1 gene:ENSEEUG00000002164 transcript:ENSEEUT00000002167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLHLGTLLLRHGYLYLRSPCCLELRPDDTPYRFQVRCGGPAIYLAKKSFRKQGALLEHEK
EHYGQLQRKVSHMWDLVVTQAREQLRASKHRRKGDRLVITWQEQTYWLVNRPPPGVPSVL
EQGPEQGSHSAKRELRTKDSGFYRQEIECIRKALSRARVKSSICLEAYLKFSDQYKPHDP
IMSGCLPSNPWITDDDAYWIMNAPSVAMPTRLRVERWAFSFWELLGDSMGRTHFLEFLGK
EFSAENLCFWEACEELRHGAQAQLSHRVDAVYQQFLAPGAARWVNVDSRTMELTLGGLRQ
PHRYVLDLAQMHIYMLMKK
Download sequence
Identical sequences ENSEEUP00000001973 ENSEEUP00000001973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]