SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000002036 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000002036
Domain Number 1 Region: 6-136
Classification Level Classification E-value
Superfamily PX domain 2.35e-32
Family PX domain 0.00013
Further Details:      
 
Domain Number 2 Region: 266-337
Classification Level Classification E-value
Superfamily SH3-domain 9.58e-20
Family SH3-domain 0.00087
Further Details:      
 
Domain Number 3 Region: 440-527
Classification Level Classification E-value
Superfamily SH3-domain 1.17e-16
Family SH3-domain 0.0013
Further Details:      
 
Domain Number 4 Region: 162-199
Classification Level Classification E-value
Superfamily SH3-domain 0.000000223
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000002036   Gene: ENSEEUG00000002227   Transcript: ENSEEUT00000002234
Sequence length 841
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_1975:45070:325796:-1 gene:ENSEEUG00000002227 transcript:ENSEEUT00000002234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAYCVQDATVVDVEKRRNPSKHYVIHKVTWSDSTFQTTYRRYNKFFELQMQLLDKFPIE
GGQKDPKQRIIPFLPGKILFRRSHIRDVAVKRLKPIDEYCRALIRLPPHISQCDEVFRFF
ETRPEDVNPPKEDYGSSRRKSXXXXXXXXXXXXXXXXADSNTEPMILEQYVVVSNYKKQE
NSELSLQAGEVVDVIEKNESXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXEEKYVTVQPYTSQSKDEISFEKGVTVEVIRKNLE
GWWYIRYLGKEGWAPASYLKKAKDDLPARKKNLAGPVEIIGNIMEISNLLNKKASGDKEA
PPAEGEGPEAPITKKEISLPILCNASNGSALGVPERTSSKLAQGSPAVARIAPQRAQISS
PNLRTRPPPRRESSLGFQLPKPPEPPSVEVEYYTIAEFQSCISDGISFRGGQKAEVIDKN
SGGWWYVQIGEKEGWAPASYIDKRKKPNLSRRTSTLTRPKVPPPAPPSKPKEPEEGPAGT
GESQDSPLKLKYEEPEYDIPAFGFDSEPELSEEPAEDSGSGDKRPSQPLRPSPTSSLQRA
RFKVGGSSEDVAPEEETIYENEGFRPSAEDSDSPGGSPLSLARKNSPKSDSPKSSSLLRL
KAEKNAQAELGKNHSSASFSSSITINTTCSSSSSTSSSSSLSKNSSDLKPRSASDAGIRG
TPKVGAKKDVDLKAGLPSSARAKPSVRPKPFLNRAESQSQEKMDISTLRRQLRPTGQLQG
GLKGSKSEDSELPPQTAFESLSEGARRGSADPITLPATAPPCPSRKGREGQAAVYTTCSA
Y
Download sequence
Identical sequences ENSEEUP00000002036 ENSEEUP00000002036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]