SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000002055 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000002055
Domain Number 1 Region: 444-585
Classification Level Classification E-value
Superfamily PH domain-like 1.09e-41
Family Phosphotyrosine-binding domain (PTB) 0.00000025
Further Details:      
 
Domain Number 2 Region: 642-743
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-19
Family PDZ domain 0.0000336
Further Details:      
 
Domain Number 3 Region: 735-819
Classification Level Classification E-value
Superfamily PDZ domain-like 4.21e-16
Family PDZ domain 0.0000178
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000002055   Gene: ENSEEUG00000002247   Transcript: ENSEEUT00000002253
Sequence length 826
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_1938:314:102506:-1 gene:ENSEEUG00000002247 transcript:ENSEEUT00000002253 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPSEGPAEEAAAAGELNEAVEADLGRPASDREPPRPGDRRPRARALEEPRAQPGPLEEE
EHRESLARSASTESVFHNHTDTSEGDVLAAGRDGDEAERAQEPEDESAYAVQFRPEAEEY
TEQAEAEHAEATQRRALPNHLHFHSLEHEEAMNAAYSGYVYTHRLFPRGGDGDDEPYAEP
YADYGGLQEHVYEEIGDAPELEARAGLRLFERDEAAAYRQETLGARLHHYDERSDGESDS
PEKEAEFAPYPRMDSYEEEDIDQIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSPSPGSSSPLGAESSSIPLHPSDPTEAST
NKESRKSLASFPTYVEVPGPCDPEDLIDGIIFAANYLGSTQLLSDKTPSKNVRMMQAQEA
VSRIKMAQKLAKSRKKAPEGESQPMTEVDLFISTQRIKVLNADTQETMMHPLTISYIADI
GNIVVLMARRRMPRSNSQENVEASHPAQDGKRQYKMVCHVFESEDXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVFIEKQKGEILGVVI
VESGWGSILPTVIIANMMHGGPAEKSGKLNIGDQIMSINGTSLVGLPLSTCQSIIKGLKN
QSRVKLNIVRCPPVTTVLIRRPDLRYQLGFSVQNGIICSLMRGGIAERGGVRVGHRIIEI
NGQSVVATPHEKIVHILSNAVGEIHMKTMPAAMYRLLTAQEQPVYI
Download sequence
Identical sequences ENSEEUP00000002055 ENSEEUP00000002055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]