SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000002070 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000002070
Domain Number 1 Region: 14-345
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.74e-81
Family Protein kinases, catalytic subunit 0.00000226
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000002070
Domain Number - Region: 538-574
Classification Level Classification E-value
Superfamily XRCC4, C-terminal oligomerization domain 0.000628
Family XRCC4, C-terminal oligomerization domain 0.0091
Further Details:      
 
Domain Number - Region: 781-815
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00164
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000002070   Gene: ENSEEUG00000002254   Transcript: ENSEEUT00000002269
Sequence length 1415
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_6980:159:21324:-1 gene:ENSEEUG00000002254 transcript:ENSEEUT00000002269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPLVTKVKELRLQREDFEILKVIGRGAFGEVAVVRQRDSGQVFAMKMLHKWEMLKRAETA
CFREERDVLVKGDSRWVTALHYAFQDEEYLYLVMDYYAGGDLLTLLSRFEDRLPPELAQF
YLAEMVLAIHSLHQLGYVHRDVKPDNILLDMNGHIRLADFGSCLRLNTSGTVDSSVAVGT
PDYISPEILQAMEEGKGHYGPQCDWWSLGVCAYELLFGETPFYAESLVETYGKIMNHEDH
LQFPPDTPDVPASARDLIRQLLCRQEERLGRGGLDDFRKHPFFQGVDWDRLASSTAPYIP
ELQGPMDTSNFDVDDDTLNHPGTLPPPSHGVFSGHHLPFVGFTYTSSSAGPDGNSEARAA
LERKLRGLEQEKAELSRKLQEALHSPSDRRELEQLRKEVQTLRNRLAETLRDTKSPSSQT
DGSDLRQERDQPHQELAEARVHQAELLRGLEEAQALGSQLQAAQAVQKELQSHVATLSRE
VTQAQQEGGPEPETPRVKTVHAIPETNGTRSPEAELREEVAVLRGQLEQARSRGKEELVL
GRLQEENQRLSREQERLVEELEREQQDKQRLEGERRETEKNWEAQIADILTWVNDEKVSR
GYLQTLATKMAEELETLRNAGTQTLPTRPLDHQWKARRLQKMEASARLELQSALEAEIRA
KQGLQERLTRVLEAQLRAESRLQEAEQRSQGLQRELMALREELHARGPGDTKSLNPFIPF
LSFRSSERDANKETGITGEAPRSGPEPELRPKGRRSLRLGAVFPRTSATTPSPVEGPTAK
SGSHSLRPRSFPSPTQCLRCTSLMLRLCRHGLSCDXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXPVYALKEAYDNGLSVRSHTLCAAILXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXNFSHLVEVGPIYRKAGAQALCLAPTGKGPGGHILGQQRPHSFSEASRRPASM
SSKGLAGNPDPTAKRKPWLPLSSEVFCPQGSLSPM
Download sequence
Identical sequences ENSEEUP00000002070 ENSEEUP00000002070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]