SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000002102 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000002102
Domain Number 1 Region: 178-283
Classification Level Classification E-value
Superfamily Second domain of FERM 3.93e-37
Family Second domain of FERM 0.00000422
Further Details:      
 
Domain Number 2 Region: 98-177
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.85e-27
Family First domain of FERM 0.0000842
Further Details:      
 
Domain Number 3 Region: 348-423
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000451
Family Third domain of FERM 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000002102   Gene: ENSEEUG00000002292   Transcript: ENSEEUT00000002303
Sequence length 878
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_1088:54495:156995:1 gene:ENSEEUG00000002292 transcript:ENSEEUT00000002303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTETGPDSDVKKAQEEAPQQPEAAAAATTPVTPIGHGHLEANSNEKHPPQQDARPMEQS
LDMEEKDYSEADGLSERTTPSKAQKSPQKIAKKYKSTICRVTLLDASEYECEVEKHGRGQ
VLFDLVCEHLNLLEKDYFGLTFCDADSQKNWLDPSKEIKKQIRSSPWNFAFTVKFYPPDP
AQLTEDITRYYLCLQLRADIITGRLPCSFVTHALLGSYAVQAELGDYDTEEHVGNYVSEL
RFAPNQTRELEERIMELHKTYRGMTPGEAEIHFLENAKKLSMYGVDLHHAKXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYEQFESTIALSSPNHRSP
KRLKVCIEHHTFFRLVSPEPPPKGFLVMGSKFRYSGRTQAQTRQASALIDRPAPFFERSS
SKRYTMSRSLDGAEFSRPASVSENHDSGPDGDKLEEDGESGGRRSEAEEGEVRTPTKIKD
LKPEQETTPRHKQEFLDPEDVLLRRQASINELKRTLKEPNSKLIHRDRDWERERRLPSSP
ASPSPKGTPEKASEREPRKKSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPVKTETMTVSSLAIRKKIEPEAILQTRVAA
VDTTQQVDGAAPGGKEFMTTTPSITTETISTTMDNSLKSGKGAAAMIPGPQTVATEIRSL
SPIIGKDVLTSTYGATAETLSTSTTTHVTKTVKGGFSETRIEKRIIITGDEDVDQDQALA
LAIKEAKLQHPDMLVTKAVVYRETDPSPEERDKKPQES
Download sequence
Identical sequences ENSEEUP00000002102 ENSEEUP00000002102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]