SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000002117 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000002117
Domain Number 1 Region: 154-239
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 4.14e-32
Family MBT repeat 0.0000157
Further Details:      
 
Domain Number 2 Region: 603-685
Classification Level Classification E-value
Superfamily SAM/Pointed domain 6.28e-17
Family SAM (sterile alpha motif) domain 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000002117   Gene: ENSEEUG00000002319   Transcript: ENSEEUT00000002320
Sequence length 687
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_1542:3825:149587:-1 gene:ENSEEUG00000002319 transcript:ENSEEUT00000002320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PMNDKKEIQEKPSQSSTSSVQSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXYQMNVSSWPMFLLRTLTGSEMAPIVLAEPPKPALNNFKVGMKLEAIDRKNPYLIC
PATISNVKGDDVYVTFDGWSGAFDYWCKYDCRDIFPVGWCHLTGDVLQPPGNQTPIIKNT
VKAQTCSSKANRRSMQTAQKTAVAVTAQQTRKSGRSKASVLTSASKKGSTVKITTQRKRG
PSSGRKEKPLPTVSSTSSTSVKSQTKDSSPSIDKNAASSKVVMSTVCVYINKDGNSGPYL
DQAKIQQLPDHFGPGPVNVVLRRTVQACLDCAFESKTVFGFLKSDHRGGEVITASFDGET
HSAQLPPVNSASFALRFLETFCHSLQCDNLLSSQPFSAYRGNNPSAAPHSTAKPAKEDIG
KKSTKRPSKHPPPFVLTPSSKFPKTSFHFNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSHEG
APDSSVPKQGLLTDPSTWSVEEVIEYIKCKDPQIAVLLTDLFRQHEIDGKALLLLKSDVV
MKYMGLKLGPALKLCHYIEKLKEGKYN
Download sequence
Identical sequences ENSEEUP00000002117 ENSEEUP00000002117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]