SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000002186 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000002186
Domain Number 1 Region: 908-977
Classification Level Classification E-value
Superfamily SAM/Pointed domain 9.13e-18
Family SAM (sterile alpha motif) domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000002186   Gene: ENSEEUG00000002387   Transcript: ENSEEUT00000002392
Sequence length 978
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_7215:24487:137287:-1 gene:ENSEEUG00000002387 transcript:ENSEEUT00000002392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTEPNPGTSSVSTTTSSSTTTTITTSSSRMQQPQISVYSGTDRHAVQXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXASLSSGRPSTSPTGSVTQQS
SMSQTSINLSTSPTPAQLISRSQASSSTSGSITQQTMLLGSTSPTLTASQAQMYLRAQML
IFTPATTVAAVQSDIPVVSSSSSSSCQSAATQVQNLTLRSQKLGVLSSSQNGPPKSSSQT
QSLTICHNKTTVTSSKISQRDPSPESNKKGESPSLESRSTAVTRTSSIHQLIAPASYPPI
QPHPLIKHQQIPLHSPPPKVSHHQLILQQQQQQQIQPITLQSPSQDPPPSQQGVPLPNHG
LPPGPSNGQSQDWSPIQSHPPPLTISPGQAQAGQQSVVVSPPPPHSPRQSPTIIIDPQGL
IQPHPLVSSALQPGPSLQQPTTSQVQPTAQLNLPSHLPLPASPVVHIGPVQQSALVSPGQ
QIVSPTSHQQYSTLQSSPIPIATPPQMSASPPAQMPPLPLPSMQSLQVQPDILSQGQVLV
QNALVSEEDLPAAEALVQLPFQTLPPPQTVAVNLQVQPPAPVDPPVVYQVEDVCEEEMPE
ESDECVRMDRTPPPPTLSPAAITVGRGEDLTSDHPLLEQVELPAVASVSASVIKSPSDPS
HVSLPPPPLLLPAAATRSNSTSLSNSLSNLENKPPQAIVKPQILTHVIEGFVIQEGLEPF
PVSRSSLLTEQPVKKRPLLDNQVINSVCVQPELQNNTKHADNSSDTEMEDMIAEETLEEM
DSELLKCEFCGKMGYANEFLRSKRFCTMSCAKXXXXXXXXXXXXXXXNRKPDQSLRCDRP
VPDAGVYMQHLPITYPSAEEDLVSHEDSVPSAMTTRLRRQNERERERELRDVRLRKMPEN
SDLLPVAQTEPSIWTVDDVWAFIHSLPGCQDIADEFRAQEIDGQALLLLKEDHLMSAMNI
KLGPALKICARINSLKES
Download sequence
Identical sequences ENSEEUP00000002186 ENSEEUP00000002186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]