SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000002203 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000002203
Domain Number 1 Region: 26-231
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.35e-61
Family BAR domain 0.00000846
Further Details:      
 
Domain Number 2 Region: 623-693
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000881
Family SH3-domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000002203   Gene: ENSEEUG00000002396   Transcript: ENSEEUT00000002412
Sequence length 694
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_858:49035:206557:-1 gene:ENSEEUG00000002396 transcript:ENSEEUT00000002412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADIKTGIFAKNVQKRLNRAQEKVLQKLGKADETKDEQFEEYVQNFKRQEAEGTRLQREL
RGYLAAIKGMQEASMKLTESLHEVYEPDWYGREDVKMVGEKCDILWEDFHQKLVDGSLLT
LDTYLGQFPDIKNRIAKRSRKLVDYDSARHHLEALQSSKRKDESRISKAEEEFQKAQKVF
EEFNVDLQEELPSLWSRRVGFYVNTFKNVSSLEAKFHKEIAVLCHKLFEVMTKLGDQHAD
KAFTIQGAPSDSGPLRLAKTPSPPEEASPLPSPTSSPNHTLAPASPAPVRPRSPSQXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXTLPWDLWTAESARQLSKASGGSFNGFTQHDTSLFTMQTDQIS
NLAESEQVLATEPEVEEPTAAAAAPAAGLDSGLDSQAEEPGEEAVVLPGSDADVTPETTV
SAAEGAPELEAEPEKTAAPAGEGASLEEAKTDTEMAEAALDERPQPEEKKQEAAQXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXVETLHDFEAANSDELNLQRGDVVLVVPSDSEADQD
AGWLVGVKESDWLQYRDLTTYKGLFPENFTRRLD
Download sequence
Identical sequences ENSEEUP00000002203 ENSEEUP00000002203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]