SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000002228 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000002228
Domain Number 1 Region: 638-689
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000463
Family SAM (sterile alpha motif) domain 0.015
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000002228
Domain Number - Region: 121-158
Classification Level Classification E-value
Superfamily MPN010-like 0.00301
Family MPN010-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000002228   Gene: ENSEEUG00000002425   Transcript: ENSEEUT00000002439
Sequence length 1012
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_503:7391:134051:1 gene:ENSEEUG00000002425 transcript:ENSEEUT00000002439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSDASDMLAAALEQMDGIIAGSKALEYSNGIFDCQSPTSPFMGSLRALHLVEDLRALLE
MMEADEKEGLRCQVPDSTAETLVEWLQSHMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XVSVLTDQVEAQGEKIRDLEFCLEEHREKLNATEDMLQQELLSRTSLETQKLDLMAEVSN
LKLKLTAVEKDRLDYEDRFRDSEGLMQEINDLRLRIREMDSERLQYEKKLKSTKVMAKLX
XXXXXXXXXXXXXXXXXXXXXXXXDELTSLKEQLEEKESEVKRLQENLLSKMKGEGIEIL
DRDVEVQKMKKVMESLMAVNEEKDRKIEDLRQCLDRYKKTQDLGVLVQXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXSGKTVVGVPMETHLDEGLLTSSLQKSSSLSNLKKESSEGKK
EAVQKLLRDKALVESSPFGGLPPRAPGHDTSVDDNPFGTRKARSSFGRGFFKIKNNKRTA
SAPNLAETEKETSEHLGLAGGSSRMKDSQGSGPFQLTPPSPDPRKKSRGIMKLFGKLRRS
QSTTFNPEDMSEPEFRRGGTRATAGPRLGWSRDLGQSNSDLDMPFAKWTKEQVCSWLVEQ
GLGSYLNSGKHWITSGQTLLQASQQDLEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXPKKLTFSNFGNLRKKKQEDGEEYVCPMELGQSSGSTSKKGFKTGLDMRLYDEDDLDRL
EQMEDSEGTVRQIGAFSEGINNLTHMLKEDDMFKDFAAQSPSTSITDEDSNV
Download sequence
Identical sequences ENSEEUP00000002228 ENSEEUP00000002228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]