SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000002321 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000002321
Domain Number 1 Region: 54-257
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.8e-55
Family Lectin leg-like 0.0000582
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000002321   Gene: ENSEEUG00000002545   Transcript: ENSEEUT00000002540
Sequence length 356
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_6787:1181:9388:-1 gene:ENSEEUG00000002545 transcript:ENSEEUT00000002540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAWVWRWGWGRRCPGRPGLPGPGPGPITPLCLLLPLLGLVAADITDGNSEHLKREHS
LIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSREGSIWNHQXXXXXXWEMHVHFK
VHGAGKKNLHGDGIALWYARDRLVPGPVFGSKDNFHGLAIFLDTYPNDETTERVFPYISV
MVNNGSLFYDHSKDGRWTELAGCTADFRNREHDTFLAARYSRGRLTVMTDLEDKNEWKSC
IDITGRLPTGYYFRSSAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXNVDDPTGNFRSGPLTGWRVFLLLLCALLGIIVCAVVGAVVFQKRQERNKRFY
Download sequence
Identical sequences ENSEEUP00000002321 ENSEEUP00000002321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]