SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000002452 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000002452
Domain Number 1 Region: 73-210
Classification Level Classification E-value
Superfamily vWA-like 1.05e-29
Family Integrin A (or I) domain 0.001
Further Details:      
 
Domain Number 2 Region: 338-417
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000813
Family Laminin G-like module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000002452   Gene: ENSEEUG00000002657   Transcript: ENSEEUT00000002678
Sequence length 954
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_3184:11411:172789:-1 gene:ENSEEUG00000002657 transcript:ENSEEUT00000002678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQHIVFLWIVLVMYLQNSVLAEDGEIRSXXXXXXXXXXXXXXXXXXXXXXXXXIVKKWV
NITKFYIEPKFIQGGVQYRDYPILEIPLGPNSGDNLVAAMESIQYLGGNTRPGKPIQFAL
DYLLAKSSRFLTKIAVVLTDGKSQDEVKDAAEAARDSKITLFAIGVGSETEDAELRAIAN
KPSSTYVFYVEDYIAISKIREVMKQKLCEESVCPTRIPXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKLFDEGWHQIRLLVTEKDITLY
IDDQQIENKSLHPVLGIFISGQTQIGKYSGKEETVQFDVQKLRIYCDPEQNNRETACEIP
GFVMECLNGPSDVGSTLAPCVCPPGKPGLQGPKGDRGQPGNPGYPGQPGQDGKPGYQGSS
GSPGVPGSPGIQGAQGLPGYKGEPGRDGEKGDRGLPGFPGLHGMPGSKGEVGFKGDKGLP
GFYGKKGSGAKGEKGNAGFPGLPGRTGEPGRHGKDGLMGSPGYKGEVGPPGSPGQDGLRG
EPGMPGFPGNQGLMGQKGEIGPPGPIGKKGAPGTPGLTGNNGLPGHPGTQGSKGNKGEPG
HQGMPGAHGLKGDKGAVGPPGEPGYLGLPGXXXXXGDKGIQGEKGIQGQKGENGRQGTPG
QQGIQGLHGSKGERGEKGEPGLRGAVGPKGDSGLDGLMGPVGPQGQPGETGPQGPPGLDG
KPGGFSEQFIRQVCTDVLRAQLPVLLQSGRIENCDRCRSQQGSPGIPGPPGPIGPEGPRG
LPGAPGRDGVPGLMGAPGRPGARGLKGLPGRNGAKGNQGFGYPGEQGPPGPPXXXXXXXX
XXXGPRGDPGLPGKDGNHGKPGIQGQPGSPGICDPSLCFSVIVGRDPFRKGPNY
Download sequence
Identical sequences ENSEEUP00000002452 ENSEEUP00000002452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]