SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000002458 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000002458
Domain Number 1 Region: 104-278
Classification Level Classification E-value
Superfamily EF-hand 1.02e-39
Family Calmodulin-like 0.00000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000002458   Gene: ENSEEUG00000002682   Transcript: ENSEEUT00000002684
Sequence length 280
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_2879:36262:57905:-1 gene:ENSEEUG00000002682 transcript:ENSEEUT00000002684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVNGLGHI
TRFHGNSSLPTALANPASLRPHRPRPLEPDSVEDEFELSTVCHRPEGLEQLQEQTKFTRK
ELQVLYRGFKNECPSGIVNEENFKQIYSQFFPQGDSSTYATSLALTQHDSDSEDFVAGLS
VILRGTIDDRLNWAFNLYDLNKDGCITKEEMLDIMKSIYDMMGKYTYPALREEAPREHVE
SFFQKMDRNKDGVVTIEEFIESCQKDENIMRSMRLFDNVI
Download sequence
Identical sequences ENSEEUP00000002458 ENSEEUP00000002458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]